FRMD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FRMD1 Antibody [NBP1-90832] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemistry-Paraffin: FRMD1 Antibody [NBP1-90832] - Staining of human thymus shows strong cytoplasmic positivity in medullary cells.
Immunohistochemistry-Paraffin: FRMD1 Antibody [NBP1-90832] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRMD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEI
Specificity
Specificity of human FRMD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRMD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 3
using
NBP1-90832 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRMD1 Antibody

  • FERM domain containing 1
  • FLJ00181

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-83716
Species: Hu
Applications: IHC, IHC-P
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54331
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
H00134391-B01P
Species: Hu
Applications: WB, ELISA, Flow
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-80518
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-84565
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-53235
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
AF6278
Species: Hu, Mu
Applications: WB
NBP1-90642
Species: Hu
Applications: IHC, IHC-P
H00060485-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-48017
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-82865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
NBP1-78381
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FRMD1 Antibody (NBP1-90832) (0)

There are no publications for FRMD1 Antibody (NBP1-90832).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FRMD1 Antibody (NBP1-90832) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-90832:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence FRMD1 NBP1-90832
Enlarge
reviewed by:
Anonymous
IF Human 04/11/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedSaos2 Cultured Osteosarcoma Cells
SpeciesHuman
Lotab122109
CommentsAntibody worked well for visualizing FRMD1 localization in paraformaldehyde-fixed cells. Slightly high background signal.

Blocking

Blocking DetailsTBST for 1 hour at room temperature

Primary Anitbody

Dilution Ratio1:1000 in TBST, 1 hour at room temperature

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, IC Alexa Fluor® 594
Secondary Manufacturer Cat#ab150092
Secondary Concentration0.2 ug/mL

Details

Detection NotesOpera high-throughput confocal microscope, 300ms exposure
Fixation DetailsFixed with 4% paraformaldehyde in PBS at room temperature for 20 minutes, permeabilized with TBST at room temperature for 1h
Wash DescriptionTBST, 3 washes at 5 minutes each

Comments

CommentsAntibody worked well for visualizing FRMD1 localization in paraformaldehyde-fixed cells. Slightly high background signal.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FRMD1 Antibody (NBP1-90832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FRMD1 Products

Array NBP1-90832

Bioinformatics Tool for FRMD1 Antibody (NBP1-90832)

Discover related pathways, diseases and genes to FRMD1 Antibody (NBP1-90832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRMD1 Antibody (NBP1-90832)

Discover more about diseases related to FRMD1 Antibody (NBP1-90832).
 

Pathways for FRMD1 Antibody (NBP1-90832)

View related products by pathway.

PTMs for FRMD1 Antibody (NBP1-90832)

Learn more about PTMs related to FRMD1 Antibody (NBP1-90832).

Blogs on FRMD1

There are no specific blogs for FRMD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
04/11/2014
Application: IF
Species: Human

Bioinformatics

Gene Symbol FRMD1