Recombinant Human Frizzled-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Frizzled-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 55-157 of Human FZD3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

Protein/Peptide Type
Partial Recombinant Protein
Gene
FZD3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Frizzled-3 Protein

  • frizzled (Drosophila) homolog 3
  • frizzled homolog 3 (Drosophila)
  • Frizzled3
  • Frizzled-3
  • Fz-3
  • FZD3
  • hFz3

Background

FZD3 - frizzled homolog 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1120
Species: Mu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF198
Species: Mu
Applications: WB, IHC
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-23659
Species: Hu, Mu, Rt, Pm
Applications: WB
NB100-2439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
645-WN/CF
Species: Hu, Mu
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
H00007976-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Frizzled-3 Partial Recombinant Protein (H00007976-Q01) (0)

There are no publications for Frizzled-3 Partial Recombinant Protein (H00007976-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-3 Partial Recombinant Protein (H00007976-Q01) (0)

There are no reviews for Frizzled-3 Partial Recombinant Protein (H00007976-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-3 Partial Recombinant Protein (H00007976-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Frizzled-3 Products

Bioinformatics Tool for Frizzled-3 Partial Recombinant Protein (H00007976-Q01)

Discover related pathways, diseases and genes to Frizzled-3 Partial Recombinant Protein (H00007976-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-3 Partial Recombinant Protein (H00007976-Q01)

Discover more about diseases related to Frizzled-3 Partial Recombinant Protein (H00007976-Q01).
 

Pathways for Frizzled-3 Partial Recombinant Protein (H00007976-Q01)

View related products by pathway.

PTMs for Frizzled-3 Partial Recombinant Protein (H00007976-Q01)

Learn more about PTMs related to Frizzled-3 Partial Recombinant Protein (H00007976-Q01).
 

Research Areas for Frizzled-3 Partial Recombinant Protein (H00007976-Q01)

Find related products by research area.

Blogs on Frizzled-3

There are no specific blogs for Frizzled-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Wnt-5a
645-WN-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Frizzled-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD3
Entrez