FRA10AC1 Antibody

Images

 
Immunohistochemistry-Paraffin: FRA10AC1 Antibody [NBP1-88533] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRA10AC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRA10AC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FRA10AC1 Protein (NBP1-88533PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRA10AC1 Antibody

  • C10orf4fragile site 10q23.3
  • chromosome 10 open reading frame 4
  • F26C11.1-like
  • FRA10A
  • fragile site, folic acid type, rare, fra(10)(q23.3) or fra(10)(q24.2) candidate1
  • protein FRA10AC1
  • rare folic acid-type fragile site, FRA(10)(q23.3), candidate gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP2-13557
Species: Hu
Applications: IHC, IHC-P
NBP1-82867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00007580-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-13195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55238
Species: Hu
Applications: ICC/IF
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88533
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FRA10AC1 Antibody (NBP1-88533) (0)

There are no publications for FRA10AC1 Antibody (NBP1-88533).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRA10AC1 Antibody (NBP1-88533) (0)

There are no reviews for FRA10AC1 Antibody (NBP1-88533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FRA10AC1 Antibody (NBP1-88533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRA10AC1 Products

Bioinformatics Tool for FRA10AC1 Antibody (NBP1-88533)

Discover related pathways, diseases and genes to FRA10AC1 Antibody (NBP1-88533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRA10AC1 Antibody (NBP1-88533)

Discover more about diseases related to FRA10AC1 Antibody (NBP1-88533).
 

Pathways for FRA10AC1 Antibody (NBP1-88533)

View related products by pathway.

PTMs for FRA10AC1 Antibody (NBP1-88533)

Learn more about PTMs related to FRA10AC1 Antibody (NBP1-88533).

Blogs on FRA10AC1

There are no specific blogs for FRA10AC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRA10AC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRA10AC1