ZNF19 Antibody

Immunocytochemistry/Immunofluorescence: ZNF19 Antibody [NBP2-56078] - Staining of human cell line MCF7 shows localization to mitochondria.

Immunohistochemistry-Paraffin: ZNF19 Antibody [NBP2-56078] - Staining of human cervix, uterine shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZNF19 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF19 Recombinant Protein Antigen (NBP2-56078PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF19 Antibody

• KOX12MGC51021
• zinc finger protein 19 (KOX 12)
• zinc finger protein 19
• Zinc finger protein KOX12

Background

"The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF19