![Western Blot: ZNF32 Antibody [H00007580-B01P] - Analysis of ZNF32 expression in transfected 293T cell line by ZNF32 polyclonal antibody. Lane 1: ZNF32 transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/ZNF32-Antibody-Western-Blot-H00007580-B01P-img0004.jpg "Western Blot: ZNF32 Antibody [H00007580-B01P] - Analysis of ZNF32 expression in transfected 293T cell line by ZNF32 polyclonal antibody. Lane 1: ZNF32 transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ZNF32 (NP_001005368.1, 1 a.a. - 273 a.a.) full-length human protein. MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL |
| Specificity | ZNF32 - zinc finger protein 32, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ZNF32 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ZNF32 Antibody (H00007580-B01P)Discover more about diseases related to ZNF32 Antibody (H00007580-B01P).
| Pathways for ZNF32 Antibody (H00007580-B01P)View related products by pathway.
|
Research Areas for ZNF32 Antibody (H00007580-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF32 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: ZNF32 Antibody [H00007580-B01P] - Analysis of purified antibody to ZNF32 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize2/ZNF32-Antibody-Immunocytochemistry-Immunofluorescence-H00007580-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZNF32 Antibody [H00007580-B01P] - Analysis of purified antibody to ZNF32 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)")
![RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/RBP4_DRB400_ELISA_169.jpg)
![RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/DATA_RBP4_DRB400_ELISA_804.jpg)
![Immunocytochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax2_AF3364_Immunocytochemistry_14405.jpg)
![Western Blot Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-western-blot-145202183852.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images2/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")