ZNF32 Antibody

Images

 
Western Blot: ZNF32 Antibody [H00007580-B01P] - Analysis of ZNF32 expression in transfected 293T cell line by ZNF32 polyclonal antibody. Lane 1: ZNF32 transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ZNF32 Antibody [H00007580-B01P] - Analysis of purified antibody to ZNF32 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF32 Antibody Summary

Immunogen
ZNF32 (NP_001005368.1, 1 a.a. - 273 a.a.) full-length human protein. MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL
Specificity
ZNF32 - zinc finger protein 32,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZNF32
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF32 Antibody

  • Zinc finger and SCAN domain-containing protein 14
  • zinc finger protein 396
  • ZSCAN14FLJ31213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13557
Species: Hu
Applications: IHC, IHC-P
NBP1-82867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55238
Species: Hu
Applications: ICC/IF
NBP2-16528
Species: Hu
Applications: WB, ICC/IF
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NBP1-92280
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
423-F8/CF
Species: Hu, Mu

Publications for ZNF32 Antibody (H00007580-B01P) (0)

There are no publications for ZNF32 Antibody (H00007580-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF32 Antibody (H00007580-B01P) (0)

There are no reviews for ZNF32 Antibody (H00007580-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF32 Antibody (H00007580-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF32 Products

Bioinformatics Tool for ZNF32 Antibody (H00007580-B01P)

Discover related pathways, diseases and genes to ZNF32 Antibody (H00007580-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF32 Antibody (H00007580-B01P)

Discover more about diseases related to ZNF32 Antibody (H00007580-B01P).
 

Pathways for ZNF32 Antibody (H00007580-B01P)

View related products by pathway.

Blogs on ZNF32

There are no specific blogs for ZNF32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF32
Entrez
Uniprot