FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Western Blot: FPRL1/FPR2 Antibody (2G8) [H00002358-M03] - Analysis of FPR2 expression in HeLa.

ELISA: FPRL1/FPR2 Antibody (2G8) [H00002358-M03] - Detection limit for recombinant GST tagged FPR2 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
• Specificity: FPRL1 - formyl peptide receptor-like 1 (2G8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FPR2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

• ALXR
• FMLP-R-I
• FMLP-R-II
• FMLPX
• formyl peptide receptor 2
• Formyl peptide receptor-like 1RFP
• FPR2
• FPR2A
• FPRH1FMLP-related receptor I
• FPRL1
• FPRL1LXA4 receptor
• HM63
• HM63FPRH2
• lipoxin A4 receptor (formyl peptide receptor related)
• Lipoxin A4 receptor
• LXA4 Receptor
• LXA4RFMLP-R-I
• N-formyl peptide receptor 2
• RFP

Background

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FPRL1/FPR2 Antibody (H00002358-M03). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
   • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Bioinformatics

• Gene Symbol: FPR2
• Entrez:
  • 2358(Human)
• Uniprot:
  • AAH29125(Human)