FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR |
| Specificity |
FPRL1 - formyl peptide receptor-like 1 (2G8) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
FPR2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free
Background
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for FPRL1/FPR2 Antibody (H00002358-M03) (0)
There are no publications for FPRL1/FPR2 Antibody (H00002358-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FPRL1/FPR2 Antibody (H00002358-M03) (0)
There are no reviews for FPRL1/FPR2 Antibody (H00002358-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FPRL1/FPR2 Antibody (H00002358-M03). (Showing 1 - 1 of 1 FAQ).
-
I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
- To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.
Secondary Antibodies
| |
Isotype Controls
|
Additional FPRL1/FPR2 Products
Research Areas for FPRL1/FPR2 Antibody (H00002358-M03)
Find related products by research area.
|
Blogs on FPRL1/FPR2