FOXS1 Antibody - BSA Free

Western Blot: FOXS1 Antibody [NBP2-84032] - WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Brain

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FOXS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOXS1 Antibody - BSA Free (NBP2-84032) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse FOXS1. Peptide sequence: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FOXS1 Antibody - BSA Free

• FKHL18
• forkhead (Drosophila)-like 18
• forkhead box protein S1
• forkhead box S1
• Forkhead-like 18 protein
• forkhead-related activator 10
• Forkhead-related transcription factor 10
• forkhead-related transcription factor FREAC-10
• FREAC-10
• FREAC10forkhead-like 18 (Drosophila)
• MGC4544

Background

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXS1