FOXS1 Antibody - Azide and BSA Free

Western Blot: FOXS1 Antibody [H00002307-B01P] - Analysis of FOXS1 expression in 293.

Immunocytochemistry/Immunofluorescence: FOXS1 Antibody [H00002307-B01P] - Analysis of purified antibody to FKHL18 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: FOXS1 Antibody [H00002307-B01P] - Analysis of FOXS1 expression in transfected 293T cell line by FOXS1 polyclonal antibody. Lane 1: FKHL18 transfected lysate(36.3 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FOXS1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: FKHL18 (NP_004109.1, 1 a.a. - 330 a.a.) full-length human protein. MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
• Specificity: FKHL18 - forkhead-like 18 (Drosophila),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FOXS1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXS1 Antibody - Azide and BSA Free

• FKHL18
• forkhead (Drosophila)-like 18
• forkhead box protein S1
• forkhead box S1
• Forkhead-like 18 protein
• forkhead-related activator 10
• Forkhead-related transcription factor 10
• forkhead-related transcription factor FREAC-10
• FREAC-10
• FREAC10forkhead-like 18 (Drosophila)
• MGC4544

Background

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXS1
• Entrez:
  • 2307(Human)
• Uniprot:
  • NP_004109.1(Human)