FOXRED1 Antibody - BSA Free

Western Blot: FOXRED1 Antibody [NBP2-58140] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: FOXRED1 Antibody [NBP2-58140] - Staining of human cell line PC-3 shows localization to mitochondria.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FOXRED1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOXRED1 Antibody - BSA Free (NBP2-58140) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXRED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FOXRED1 Recombinant Protein Antigen (NBP2-58140PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FOXRED1 Antibody - BSA Free

• FAD-dependent oxidoreductase domain containing 1
• FAD-dependent oxidoreductase domain-containing protein 1
• H17

Background

FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1) is an enzyme localized to the mitochondria. Mutations in FOXRED1 are associated with mitochondrial complex I deficiency, which is associated with Lehigh syndrome and leads to increased production of superoxide radicals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXRED1