FOXR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FOXR2 Antibody [NBP1-81870] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
Immunohistochemistry: FOXR2 Antibody [NBP1-81870] - Staining of human pancreas shows strong cytoplasmic positivity in a subset of cells in exocrine pancreas.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOXR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHS
Specificity
Specificity of human FOXR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-81870.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23685747)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FOXR2 Antibody

  • Forkhead box protein N6
  • forkhead box protein R2
  • forkhead box R2
  • FOXN6MGC21658

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00283150-Q01
Species: Hu
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-88148
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-16521
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-23665
Species: Mu, Rt
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-83109
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67892
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-56594
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002306-Q01
Species: Hu
NBP1-91611
Species: Hu, Mu, Rt, Ca, GP
Applications: WB

Publications for FOXR2 Antibody (NBP1-81870)(1)

Reviews for FOXR2 Antibody (NBP1-81870) (0)

There are no reviews for FOXR2 Antibody (NBP1-81870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FOXR2 Antibody (NBP1-81870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXR2 Products

Bioinformatics Tool for FOXR2 Antibody (NBP1-81870)

Discover related pathways, diseases and genes to FOXR2 Antibody (NBP1-81870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXR2 Antibody (NBP1-81870)

Discover more about diseases related to FOXR2 Antibody (NBP1-81870).

Blogs on FOXR2

There are no specific blogs for FOXR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXR2