FOXN2 Antibody - BSA Free

Western Blot: FOXN2 Antibody [NBP2-82826] - WB Suggested Anti-FOXN2 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FOXN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOXN2 Antibody - BSA Free (NBP2-82826) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of FOXN2. Peptide sequence: LIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMML The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FOXN2 Antibody - BSA Free

• forkhead box N2
• Human T-cell leukemia virus enhancer factorHTLFforkhead box protein N2

Background

Human T-cell leukemia virus enhancer factor is a forkhead domain binding protein. HTLF may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXN2