FOXN2 Antibody (9K7D9)

Western Blot: FOXN2 Antibody (9K7D9) [NBP3-33372] - Western blot analysis of extracts from wild type (WT) and FOXN2 knockout (KO) HeLa(KO) cells, using [KO Validated] FOXN2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 9K7D9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FOXN2 Antibody (9K7D9) Summary

• Description: Novus Biologicals Rabbit FOXN2 Antibody (9K7D9) (NBP3-33372) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 204-431 of human FOXN2 (NP_002149.2).
  
  Sequence:
  QPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FOXN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for FOXN2 Antibody (9K7D9)

• forkhead box N2
• Human T-cell leukemia virus enhancer factorHTLFforkhead box protein N2

Background

Human T-cell leukemia virus enhancer factor is a forkhead domain binding protein. HTLF may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXN2