Follistatin-like 4/FSTL4 Antibody

Images

 
Immunohistochemistry-Paraffin: Follistatin-like 4/FSTL4 Antibody [NBP1-91913] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells with distinct extracellular material.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Follistatin-like 4/FSTL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS
Specificity
Specificity of human Follistatin-like 4/FSTL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSTL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in scientific literature (bioRxiv Oct 4 2018).
Control Peptide
Follistatin-like 4/FSTL4 Protein (NBP1-91913PEP)
Publications
Read Publication using
NBP1-91913 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (VanderWall K et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Follistatin-like 4/FSTL4 Antibody

  • Follistatin like 4
  • Follistatin-like 4
  • Follistatin-like protein 4
  • follistatin-related protein 4
  • FSL4
  • FSTL4
  • KIAA1061

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67727
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87894
Species: Hu
Applications: IHC, IHC-P
NBP3-04674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14208
Species: Hu
Applications: IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-93618
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97564
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-Fr, IP, CyTOF-ready
NBP1-98474
Species: Hu
Applications: WB
NBP2-33471
Species: Hu
Applications: IHC, IHC-P
NBP1-91913
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Follistatin-like 4/FSTL4 Antibody (NBP1-91913)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-91913 Applications Species
VanderWall K, Lu B, Wang S, Meyer J. Differential Susceptibility of Rat Retinal Ganglion Cell Subtypes Following Optic Nerve Crush bioRxiv Oct 4 2018 (ICC/IF, Rat) ICC/IF Rat

Reviews for Follistatin-like 4/FSTL4 Antibody (NBP1-91913) (0)

There are no reviews for Follistatin-like 4/FSTL4 Antibody (NBP1-91913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Follistatin-like 4/FSTL4 Antibody (NBP1-91913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Follistatin-like 4/FSTL4 Products

Bioinformatics Tool for Follistatin-like 4/FSTL4 Antibody (NBP1-91913)

Discover related pathways, diseases and genes to Follistatin-like 4/FSTL4 Antibody (NBP1-91913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Follistatin-like 4/FSTL4 Antibody (NBP1-91913)

Discover more about diseases related to Follistatin-like 4/FSTL4 Antibody (NBP1-91913).

Blogs on Follistatin-like 4/FSTL4

There are no specific blogs for Follistatin-like 4/FSTL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Follistatin-like 4/FSTL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSTL4