FMNL3 Recombinant Protein Antigen

Images

 
There are currently no images for FMNL3 Protein (NBP1-84091PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FMNL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMNL3.

Source: E.coli

Amino Acid Sequence: LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FMNL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84091.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FMNL3 Recombinant Protein Antigen

  • formin-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-33431
Species: Hu
Applications: WB, IHC, IHC-P
H00342184-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023002-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, PLA
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-80419
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-93579
Species: Hu
Applications: IHC, IHC-P
NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P

Publications for FMNL3 Protein (NBP1-84091PEP) (0)

There are no publications for FMNL3 Protein (NBP1-84091PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMNL3 Protein (NBP1-84091PEP) (0)

There are no reviews for FMNL3 Protein (NBP1-84091PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FMNL3 Protein (NBP1-84091PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FMNL3 Products

Bioinformatics Tool for FMNL3 Protein (NBP1-84091PEP)

Discover related pathways, diseases and genes to FMNL3 Protein (NBP1-84091PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMNL3 Protein (NBP1-84091PEP)

Discover more about diseases related to FMNL3 Protein (NBP1-84091PEP).
 

Pathways for FMNL3 Protein (NBP1-84091PEP)

View related products by pathway.

PTMs for FMNL3 Protein (NBP1-84091PEP)

Learn more about PTMs related to FMNL3 Protein (NBP1-84091PEP).

Blogs on FMNL3

There are no specific blogs for FMNL3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FMNL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FMNL3