FKBP14 Antibody - BSA Free

Immunohistochemistry-Paraffin: FKBP14 Antibody [NBP1-83891] - Staining of human cerebral cortex shows distinct nucleolar and cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FKBP14 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP14
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FKBP14 Protein (NBP1-83891PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FKBP14 Antibody - BSA Free

• 22 kDa FK506-binding protein
• EC 5.2.1.8
• FK506 binding protein 14 (22 kDa)
• FK506 binding protein 14, 22 kDa
• FK506-binding protein 14
• FKBP-14
• FKBP-22
• FKBP22PPIase FKBP14
• FLJ20731
• peptidyl-prolyl cis-trans isomerase FKBP14,22 kDa FKBP
• rotamase

Background

PPIases accelerate the folding of proteins during protein synthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FKBP14