FKBP14 Antibody

Images

 
Immunohistochemistry-Paraffin: FKBP14 Antibody [NBP1-83891] - Staining of human cerebral cortex shows distinct nucleolar and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FKBP14 Protein (NBP1-83891PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP14 Antibody

  • 22 kDa FK506-binding protein
  • EC 5.2.1.8
  • FK506 binding protein 14 (22 kDa)
  • FK506 binding protein 14, 22 kDa
  • FK506-binding protein 14
  • FKBP-14
  • FKBP-22
  • FKBP22PPIase FKBP14
  • FLJ20731
  • peptidyl-prolyl cis-trans isomerase FKBP14,22 kDa FKBP
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-83891
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FKBP14 Antibody (NBP1-83891) (0)

There are no publications for FKBP14 Antibody (NBP1-83891).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP14 Antibody (NBP1-83891) (0)

There are no reviews for FKBP14 Antibody (NBP1-83891). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FKBP14 Antibody (NBP1-83891) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP14