Home » FKBP12 » FKBP12 Proteins » FKBP12 Recombinant Protein Antigen

FKBP12 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FKBP12 Protein (NBP2-14017PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FKBP12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FKBP1A.

Source: E.coli

Amino Acid Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FKBP1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-14017.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FKBP12 Recombinant Protein Antigen

  • 12 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 1A, 12kDa
  • FK506-binding protein 1A
  • FKBP1
  • FKBP12
  • FKBP12C
  • FKBP12FKBP12-Exip3
  • FKBP-12T-cell, 12-kD
  • FKBP1a
  • FKBP-1A
  • peptidyl-prolyl cis-trans isomerase FKBP1A
  • PKC12
  • PPIase FKBP1A
  • PPIASE
  • protein kinase C inhibitor 2
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
Immunohistochemistry: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Used at 5 ug/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate staining of proximal convoluted tubules of the kidney. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain.
(5 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Cyclophilin A
Antibody (1F4-1B5)
H00005478-M01
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - PPIA monoclonal antibody (M01), clone 1F4-1B5 Analysis of PPIA expression in Jurkat.
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.Lane 1: PPIA transfected lysate(18 KDa).Lane 2: Non-transfected lysate.
ELISA: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.
(4 Publications)
Species: Hu
Applications: WB, ELISA
PPIL1 Antibody
NBP2-57062
Western Blot: PPIL1 Antibody [NBP2-57062] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: PPIL1 Antibody [NBP2-57062] - Staining of human cell line SK-MEL-30 shows localization to nucleoli.
Species: Hu
Applications: WB, ICC/IF
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11 Analysis of FKBP4 expression in HeLa.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
Cyclophilin A
Antibody (1F4-1B5)
H00005478-M01
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - PPIA monoclonal antibody (M01), clone 1F4-1B5 Analysis of PPIA expression in Jurkat.
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.Lane 1: PPIA transfected lysate(18 KDa).Lane 2: Non-transfected lysate.
ELISA: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.
(4 Publications)
Species: Hu
Applications: WB, ELISA
Ryanodine Receptor
1 Antibody (34C)
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor 1 Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P, IP, B/N, IF
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PDZD2 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDZD2 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
Pin1 Antibody
(257417)
MAB2294
Western blot shows lysates of Balb/3T3 mouse embryonic fibroblast cell line, U2OS human osteosarcoma cell line, HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Pin1 at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Pin1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu, Mu
Applications: WB, IHC, IP
FKBP13/FKBP2
Antibody
NBP2-38604
Western Blot: FKBP13/FKBP2 Antibody [NBP2-38604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: FKBP13/FKBP2 Antibody [NBP2-38604] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining in human epididymis and skeletal muscle tissues using anti-FKBP2 antibody. Corresponding FKBP2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(13 Reviews)
(244 Publications)
Species: Hu
Ryanodine Receptor
2 Antibody
NBP1-90091
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: IHC, IHC-P
ROR
gamma/RORC/NR1F3 Anti
NBP2-24503
Western Blot: ROR gamma/RORC/NR1F3 Antibody [NBP2-24503] - Total protein from Human and mouse Thymus, Jurkat and U2OS cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ROR Gamma in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: ROR gamma/RORC/NR1F3 Antibody [NBP2-24503] - U-2 OS cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ROR gamma at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ROR gamma/RORC/NR1F3 Antibody [NBP2-24503] - IHC analysis of a formalin fixed paraffin embedded tissue section of human lymph node using 5ug/ml concentration of anti- ROR-gamma/NR1F3 antibody. The staining was developed with HRP labeled secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This antibody generated mainly a nuclear staining in a subset of cells and a weak to cytoplasmic staining was also observed in some cells.
(1 Review)
(1 Publication)
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western blot shows lysates of DU145 human prostate carcinoma cell line. PVDF membrane was probed with 0.3 µg/mL of Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for FKBP51 at approximately 51 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
FKBP51 was detected in immersion fixed paraffin-embedded sections of human prostate using 15 µg/mL Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of DU145 human prostate carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for FKBP51 at approximately 61 kDa (as indicated) using 3 µg/mL of Goat Anti-Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Calmodulin 2
Knockout HeLa Cell Ly
NBP2-66296
Calmodulin 2 Knockout HeLa Cell Lysate
Species: Hu
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Calmodulin 3
Antibody
NBP1-98474
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu
Applications: WB
HSP90 alpha
Antibody
NB120-2928
Western Blot: HSP90 alpha Antibody [NB120-2928] - Analysis of 2-fold serial dilutions of HeLa cell lysate, starting at 10 ug, per well.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NB120-2928] - Analysis of Heat Shock Protein 86 (HSP86, green) in HeLa cells and NIH3T3 cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a HSP86 polyclonal antibody, at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat-anti-rabbit IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: HSP90 alpha Antibody [NB120-2928] - Both normal and cancer biopsies of deparaffinized Human breast carcinoma tissues.
(7 Publications)
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Cyclophilin 40
Antibody
NB120-3562
Western Blot: Cyclophilin 40 Antibody [NB120-3562] - Analysis of rat spleen extracts.
Immunocytochemistry/Immunofluorescence: Cyclophilin 40 Antibody [NB120-3562] - Analysis of Cyclophilin D in HepG2 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Cyclophilin D polyclonal antibody at a dilution of 1:200 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody. Cyclophilin D staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody [NB120-3562] - Both normal and cancer biopsies of deparaffinized human Hepatocarcinoma tissue.
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Western Blot: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of gamma Synuclein on rat kidney tissue lysate using anti-gamma Synuclein antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded rat brain tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
FKBP12 Recombinant
Protein Antigen
NBP2-14017PEP
FKBP12 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FKBP12 Protein (NBP2-14017PEP) (0)

There are no publications for FKBP12 Protein (NBP2-14017PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP12 Protein (NBP2-14017PEP) (0)

There are no reviews for FKBP12 Protein (NBP2-14017PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FKBP12 Protein (NBP2-14017PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FKBP12 Protein (NBP2-14017PEP)

Discover related pathways, diseases and genes to FKBP12 Protein (NBP2-14017PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP12 Protein (NBP2-14017PEP)

Discover more about diseases related to FKBP12 Protein (NBP2-14017PEP).
 

Pathways for FKBP12 Protein (NBP2-14017PEP)

View related products by pathway.

Research Areas for FKBP12 Protein (NBP2-14017PEP)

Find related products by research area.

Blogs on FKBP12

There are no specific blogs for FKBP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human FKBP12 Protein
H00002280-P01-25ug
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
IL-2 [Unconjugated]
202-IL-010
Western blot shows lysates of Neuro-2A mouse neuroblastoma cell line, Jurkat human acute T cell leukemia cell line, and MCF-7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL Rat Anti-Human/Mouse/Rat FKBP12 Monoclonal Antibody (Catalog # MAB3777) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). For additional reference, Recombinant Human FKBP12 (Catalog # 3777-FK), recombinant human FKBP12.6, and recombinant human FKBP13 (5 ng/lane) were included. A specific band for FKBP12 was detected at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
FKBP12 Antibody (422513)
MAB3777
Western Blot: HSP90 alpha Antibody [NB120-2928] - Analysis of 2-fold serial dilutions of HeLa cell lysate, starting at 10 ug, per well.
HSP90 alpha Antibody
NB120-2928

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FKBP12 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FKBP1A