FKBP12 Recombinant Protein Antigen

Images

 
There are currently no images for FKBP12 Protein (NBP2-14017PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FKBP12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FKBP1A.

Source: E. coli

Amino Acid Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FKBP1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14017.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FKBP12 Recombinant Protein Antigen

  • 12 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 1A, 12kDa
  • FK506-binding protein 1A
  • FKBP1
  • FKBP12
  • FKBP12C
  • FKBP12FKBP12-Exip3
  • FKBP-12T-cell, 12-kD
  • FKBP1a
  • FKBP-1A
  • peptidyl-prolyl cis-trans isomerase FKBP1A
  • PKC12
  • PPIase FKBP1A
  • PPIASE
  • protein kinase C inhibitor 2
  • rotamase

Background

Immunophilins are a family of soluble receptors capable of binding to one of two major immunosuppressant agents; cyclosporin A (CsA) or FK506. Proteins that bind FK506 are termed FK506 Binding Proteins (FKBPs) and those that bind cyclosporin A are called cyclophilins (CyP). Immunophilins function as cis-trans peptidyl-prolyl isomerases (PPIase) whose activity is inhibited by their respective immunosuppressant compounds. Thus, immunophilins accelerate folding of some proteins both in vivo and in vitro by catalyzing slow steps in the initial folding and rearrangement of proline-containing proteins.FKBP12:FK506 complexes inhibit calcineurin, a calcium/calmodulin-dependent serine/threonine phosphatase which blocks T-cell activation by preventing lymphokine gene transcription. FKBP12 also plays a role in intracellular calcium regulation by associating with three types of calcium release channel complexes, cardiac and skeletal ryanodine receptors and the inositol 1,4,5-trisphosphate receptor. In interactions with members of the TGF beta family type I receptors, FKBP12 has been shown to exert an inhibitory effect on the signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
MAB4356
Species: Hu, Mu, Rt
Applications: WB
202-IL
Species: Hu
Applications: BA
NBP2-80143
Species: Am, Bv, Ca, Ch, Fi, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP2-14017PEP
Species: Hu
Applications: AC

Publications for FKBP12 Protein (NBP2-14017PEP) (0)

There are no publications for FKBP12 Protein (NBP2-14017PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP12 Protein (NBP2-14017PEP) (0)

There are no reviews for FKBP12 Protein (NBP2-14017PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FKBP12 Protein (NBP2-14017PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKBP12 Products

Research Areas for FKBP12 Protein (NBP2-14017PEP)

Find related products by research area.

Blogs on FKBP12

There are no specific blogs for FKBP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FKBP12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP1A