FKBP11 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining in human pancreas and cerebral cortex tissues using anti-FKBP11 antibody. Corresponding FKBP11 RNA-seq data are ...read more
Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in mouse liver tissue and rat liver tissue.
Immunocytochemistry/ Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Staining of human cell line A-431 shows localization to centrosome. Antibody staining is shown in green.
Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows high expression.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FKBP11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP11 Protein (NBP1-84678PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP11 Antibody

  • 19 kDa FK506-binding protein
  • EC 5.2.1.8
  • FK506 binding protein 11, 19 kDa
  • FK506-binding protein 11
  • FKBP-11
  • FKBP-19
  • FKBP19FK506 binding protein 11 (19 kDa)
  • MGC54182,19 kDa FKBP
  • peptidyl-prolyl cis-trans isomerase FKBP11
  • PPIase FKBP11
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49242
Species: Hu
Applications: IHC, IHC-P, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-87929
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-85360
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38905
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13794
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-83889
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83887
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88766
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85921
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF3589
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-84678
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FKBP11 Antibody (NBP1-84678) (0)

There are no publications for FKBP11 Antibody (NBP1-84678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP11 Antibody (NBP1-84678) (0)

There are no reviews for FKBP11 Antibody (NBP1-84678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP11 Antibody (NBP1-84678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP11 Products

Bioinformatics Tool for FKBP11 Antibody (NBP1-84678)

Discover related pathways, diseases and genes to FKBP11 Antibody (NBP1-84678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP11 Antibody (NBP1-84678)

Discover more about diseases related to FKBP11 Antibody (NBP1-84678).
 

Pathways for FKBP11 Antibody (NBP1-84678)

View related products by pathway.

PTMs for FKBP11 Antibody (NBP1-84678)

Learn more about PTMs related to FKBP11 Antibody (NBP1-84678).

Blogs on FKBP11

There are no specific blogs for FKBP11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP11