FKBP11 Antibody

Images

 
Western Blot: FKBP11 Antibody [NBP1-84678] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunocytochemistry/ Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine and endocrine pancreas.
Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in human cell line Daudi.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP11 Protein (NBP1-84678PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP11 Antibody

  • 19 kDa FK506-binding protein
  • EC 5.2.1.8
  • FK506 binding protein 11, 19 kDa
  • FK506-binding protein 11
  • FKBP-11
  • FKBP-19
  • FKBP19FK506 binding protein 11 (19 kDa)
  • MGC54182,19 kDa FKBP
  • peptidyl-prolyl cis-trans isomerase FKBP11
  • PPIase FKBP11
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84678
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FKBP11 Antibody (NBP1-84678) (0)

There are no publications for FKBP11 Antibody (NBP1-84678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP11 Antibody (NBP1-84678) (0)

There are no reviews for FKBP11 Antibody (NBP1-84678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP11 Antibody (NBP1-84678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP11 Products

Bioinformatics Tool for FKBP11 Antibody (NBP1-84678)

Discover related pathways, diseases and genes to FKBP11 Antibody (NBP1-84678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP11 Antibody (NBP1-84678)

Discover more about diseases related to FKBP11 Antibody (NBP1-84678).
 

Pathways for FKBP11 Antibody (NBP1-84678)

View related products by pathway.

PTMs for FKBP11 Antibody (NBP1-84678)

Learn more about PTMs related to FKBP11 Antibody (NBP1-84678).

Blogs on FKBP11

There are no specific blogs for FKBP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP11