FKBP11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Staining of human cell line A-431 shows localization to centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows high expression.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell line Daudi.

Analysis in human pancreas and skeletal muscle tissues using HPA041709 antibody. Corresponding FKBP11 RNA-seq data are presented for the same tissues.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.

Analysis in mouse liver tissue and rat liver tissue.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FKBP11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FKBP11 Antibody - BSA Free (NBP1-84678) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FKBP11 Protein (NBP1-84678PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FKBP11 Antibody - BSA Free

• 19 kDa FK506-binding protein
• EC 5.2.1.8
• FK506 binding protein 11, 19 kDa
• FK506-binding protein 11
• FKBP-11
• FKBP-19
• FKBP19FK506 binding protein 11 (19 kDa)
• MGC54182,19 kDa FKBP
• peptidyl-prolyl cis-trans isomerase FKBP11
• PPIase FKBP11
• rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FKBP11