Home » FKBP10 » FKBP10 Antibodies » FKBP10 Antibody (3B5)

FKBP10 Antibody (3B5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FKBP10 Antibody (3B5) [H00060681-M02] - FKBP10 monoclonal antibody (M02), clone 3B5. Analysis of FKBP10 expression in HepG2.
Western Blot: FKBP10 Antibody (3B5) [H00060681-M02] - FKBP10 monoclonal antibody (M02), clone 3B5. Analysis of FKBP10 expression in HepG2.
Sandwich ELISA: FKBP10 Antibody (3B5) [H00060681-M02] - Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FKBP10 Antibody (3B5) Summary

Immunogen
FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Specificity
FKBP10 - FK506 binding protein 10, 65 kDa (3B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FKBP10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00060681-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP10 Antibody (3B5)

  • 65 kDa FK506-binding protein
  • 65 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 10 (65 kDa)
  • FK506 binding protein 10, 65 kDa
  • FK506-binding protein 10
  • FKBP-10
  • FKBP6
  • FKBP-65
  • FKBP65PPIase FKBP10
  • FLJ20683
  • FLJ22041
  • FLJ23833
  • hFKBP65
  • Immunophilin FKBP65
  • OI6
  • peptidyl-prolyl cis-trans isomerase FKBP10
  • PPIASE
  • rotamase

Background

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclophilin A
Antibody
NBP1-30993
Western Blot: Cyclophilin A Antibody [NBP1-30993] - Analysis. Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody at a dilution of 1:20000.
Western Blot: Cyclophilin A Antibody [NBP1-30993] - (30 ug of whole cell lysate) A: HepG2 12% SDS PAGE diluted at 1:3000
Knockdown Validated: Cyclophilin A Antibody [NBP1-30993] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody diluted at 1:20000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PPIL1 Antibody
NBP3-00253
Immunohistochemistry-Paraffin: PPIL1 Antibody [NBP3-00253] - Immunochemical staining of human PPIL1 in human epididymis with rabbit polyclonal antibody (1:5000, formalin-fixed paraffin embedded sections).
Western Blot: PPIL1 Antibody [NBP3-00253] - Anti-PPIL1 rabbit polyclonal antibody at 1:500 dilution. Lane A: U87-MG Whole Cell Lysate. Lane B: Hela Whole Cell Lysate. Lane C: K562 Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 17 kDa
Immunoprecipitation: PPIL1 Antibody [NBP3-00253] - PPIL1 was immunoprecipitated using: Lane A: 0.5 mg HepG2 Whole Cell Lysate 2 ul anti-PPIL1 rabbit polyclonal antibody and 15 ul of 50 % Protein G agarose. Primary antibody: Anti-PPIL1 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Dylight 800-labeled antibody to rabbit IgG (H+L), at 1:5000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 18 kDa
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
FKBP12 Antibody
(422513)
MAB3777
Western blot shows lysates of Neuro-2A mouse neuroblastoma cell line, Jurkat human acute T cell leukemia cell line, and MCF-7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL Rat Anti-Human/Mouse/Rat FKBP12 Monoclonal Antibody (Catalog # MAB3777) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). For additional reference, Recombinant Human FKBP12 (Catalog # 3777-FK), recombinant human FKBP12.6, and recombinant human FKBP13 (5 ng/lane) were included. A specific band for FKBP12 was detected at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PDZD2 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDZD2 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, WB
Pin1 Antibody
(257417) [Unconjugate
MAB2294
Western blot shows lysates of Balb/3T3 mouse embryonic fibroblast cell line, U2OS human osteosarcoma cell line, HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Pin1 at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Pin1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 8 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Pin1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(7 Publications)
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western blot shows lysates of DU145 human prostate carcinoma cell line. PVDF membrane was probed with 0.3 µg/mL of Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for FKBP51 at approximately 51 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of DU145 human prostate carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for FKBP51 at approximately 61 kDa (as indicated) using 3 µg/mL of Goat Anti-Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
FKBP51 was detected in immersion fixed paraffin-embedded sections of human prostate using 15 µg/mL Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Cyclophilin 40
Antibody
NBP1-85364
Western Blot: Cyclophilin 40 Antibody [NBP1-85364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody [NBP1-85364] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: Cyclophilin 40 Antibody [NBP1-85364] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PPIG Antibody (4F8)
H00009360-M02
Immunocytochemistry/Immunofluorescence: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: PPIG Antibody (4F8) [H00009360-M02] - Detection limit for recombinant GST tagged PPIG is approximately 0.1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
FKBP13/FKBP2
Antibody
NBP2-38604
Immunocytochemistry/Immunofluorescence: FKBP13/FKBP2 Antibody [NBP2-38604] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cyclophilin C
Antibody (3C6) - BSA
NBP1-97946
Western Blot: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa, 1:1000 dilution.
Flow Cytometry: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis of PPIC in HeLa cell line, staining at 2-5ug for 1x106cells (red line). The secondary antibody used goat anti-mouse IgG Alexa fluor 488 conjugate. Isotype control antibody was mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human PPIC antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
MIPEP Antibody
(OTI5E7)
NBP2-45861
Flow Cytometry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by MIPEP antibody.
Immunofluorescence: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY MIPEP.
Immunohistochemistry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of Human prostate tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
Aquaporin-0
Antibody
NBP2-92773
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Human stomach using MIP antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Mouse brain using MIP antibody at dilution of 1:100 (40x lens).
Western Blot: Aquaporin-0 Antibody [NBP2-92773] - Analysis of extracts of various cell lines, using Aquaporin-0 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PPIL2 Antibody
NBP1-85360
Immunohistochemistry-Paraffin: PPIL2 Antibody [NBP1-85360] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Western Blot: PPIL2 Antibody [NBP1-85360] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: PPIL2 Antibody [NBP1-85360] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cyclophilin B
Antibody
NBP1-85358
Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-85358] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-85358] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-85358] - Staining in human thyroid gland and skeletal muscle tissues using anti-PPIB antibody. Corresponding PPIB RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela C: Hep G2 D: Molt-4 12% SDS PAGE; antibody diluted at 1:10000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COL1A2 Antibody
NBP2-92790
Western Blot: COL1A2 Antibody [NBP2-92790] - Analysis of extracts of A375 cells, using Collagen I/COL1A2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: COL1A2 Antibody [NBP2-92790] - Human placenta using Collagen I/COL1A2 Rabbit pAb (A5786) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: COL1A2 Antibody [NBP2-92790] - Analysis of A-431 cells using Collagen I/COL1A2 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FKBP10 Antibody (H00060681-M02)(1)


Reviews for FKBP10 Antibody (H00060681-M02) (0)

There are no reviews for FKBP10 Antibody (H00060681-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP10 Antibody (H00060681-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP10 Products

Bioinformatics Tool for FKBP10 Antibody (H00060681-M02)

Discover related pathways, diseases and genes to FKBP10 Antibody (H00060681-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP10 Antibody (H00060681-M02)

Discover more about diseases related to FKBP10 Antibody (H00060681-M02).
 

Pathways for FKBP10 Antibody (H00060681-M02)

View related products by pathway.

PTMs for FKBP10 Antibody (H00060681-M02)

Learn more about PTMs related to FKBP10 Antibody (H00060681-M02).

Blogs on FKBP10

There are no specific blogs for FKBP10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP10 Antibody (3B5) and receive a gift card or discount.


Bioinformatics

Gene Symbol FKBP10
Entrez
Uniprot