FKBP10 Antibody (3B5)

Images

 
Western Blot: FKBP10 Antibody (3B5) [H00060681-M02] - FKBP10 monoclonal antibody (M02), clone 3B5. Analysis of FKBP10 expression in HepG2.
Sandwich ELISA: FKBP10 Antibody (3B5) [H00060681-M02] - Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FKBP10 Antibody (3B5) Summary

Immunogen
FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Specificity
FKBP10 - FK506 binding protein 10, 65 kDa (3B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FKBP10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00060681-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP10 Antibody (3B5)

  • 65 kDa FK506-binding protein
  • 65 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 10 (65 kDa)
  • FK506 binding protein 10, 65 kDa
  • FK506-binding protein 10
  • FKBP-10
  • FKBP6
  • FKBP-65
  • FKBP65PPIase FKBP10
  • FLJ20683
  • FLJ22041
  • FLJ23833
  • hFKBP65
  • Immunophilin FKBP65
  • OI6
  • peptidyl-prolyl cis-trans isomerase FKBP10
  • PPIASE
  • rotamase

Background

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85364
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97946
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85360
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85358
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FKBP10 Antibody (H00060681-M02)(1)

Reviews for FKBP10 Antibody (H00060681-M02) (0)

There are no reviews for FKBP10 Antibody (H00060681-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP10 Antibody (H00060681-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP10 Products

Bioinformatics Tool for FKBP10 Antibody (H00060681-M02)

Discover related pathways, diseases and genes to FKBP10 Antibody (H00060681-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP10 Antibody (H00060681-M02)

Discover more about diseases related to FKBP10 Antibody (H00060681-M02).
 

Pathways for FKBP10 Antibody (H00060681-M02)

View related products by pathway.

PTMs for FKBP10 Antibody (H00060681-M02)

Learn more about PTMs related to FKBP10 Antibody (H00060681-M02).

Blogs on FKBP10

There are no specific blogs for FKBP10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP10 Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP10
Entrez
Uniprot