FKBP10 Antibody (2D4) - Azide and BSA Free

Western Blot: FKBP10 Antibody (2D4) [H00060681-M13] - Analysis of FKBP10 expression in HepG2 (Cat # L019V1).

Sandwich ELISA: FKBP10 Antibody (2D4) [H00060681-M13] - Detection limit for recombinant GST tagged FKBP10 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FKBP10 Antibody (2D4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FKBP10 Antibody (2D4) - Azide and BSA Free (H00060681-M13) is a monoclonal antibody validated for use in WB and ELISA. Anti-FKBP10 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FKBP10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP10 Antibody (2D4) - Azide and BSA Free

• 65 kDa FK506-binding protein
• 65 kDa FKBP
• EC 5.2.1.8
• FK506 binding protein 10 (65 kDa)
• FK506 binding protein 10, 65 kDa
• FK506-binding protein 10
• FKBP-10
• FKBP6
• FKBP-65
• FKBP65PPIase FKBP10
• FLJ20683
• FLJ22041
• FLJ23833
• hFKBP65
• Immunophilin FKBP65
• OI6
• peptidyl-prolyl cis-trans isomerase FKBP10
• PPIASE
• rotamase

Background

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FKBP10 Antibody (H00060681-M13)(2)

Publications using H00060681-M13

• Cabral WA, Ishikawa M, Garten M et al. Absence of the ER Cation Channel TMEM38B/TRIC-B Disrupts Intracellular Calcium Homeostasis and Dysregulates Collagen Synthesis in Recessive Osteogenesis Imperfecta. PLoS Genet 2016-07-01 [PMID: 27441836] (WB)
• Venturi G, Monti E, Carbonare LD et al. A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect. Bone. 2011-10-24 [PMID: 22061863]

Bioinformatics

• Gene Symbol: FKBP10
• Uniprot:
  • NP_068758(Human)