Filensin Antibody (6B4)

Images

 
Western Blot: Filensin Antibody (6B4) [H00000631-M02] - BFSP1 monoclonal antibody (M02), clone 6B4 Analysis of BFSP1 expression in HL-60.
Sandwich ELISA: Filensin Antibody (6B4) [H00000631-M02] - Detection limit for recombinant GST tagged BFSP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Filensin Antibody (6B4) Summary

Immunogen
BFSP1 (NP_001186 567 a.a. - 664 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS
Specificity
BFSP1 - beaded filament structural protein 1, filensin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BFSP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Filensin Antibody (6B4)

  • Beaded filament structural protein 1
  • beaded filament structural protein 1, filensin
  • CP115Lens intermediate filament-like heavy
  • filensin
  • Lens fiber cell beaded-filament structural protein CP 115
  • LIFL-H115 KD

Background

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and the protein product of this gene, filensin (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46573
Species: Hu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58661
Species: Hu
Applications: IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46573
Species: Hu
Applications: WB, IHC
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB5695
Species: Hu, Mu
Applications: WB
H00000631-M02
Species: Hu
Applications: WB, ELISA

Publications for Filensin Antibody (H00000631-M02) (0)

There are no publications for Filensin Antibody (H00000631-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Filensin Antibody (H00000631-M02) (0)

There are no reviews for Filensin Antibody (H00000631-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Filensin Antibody (H00000631-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Filensin Products

Bioinformatics Tool for Filensin Antibody (H00000631-M02)

Discover related pathways, diseases and genes to Filensin Antibody (H00000631-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filensin Antibody (H00000631-M02)

Discover more about diseases related to Filensin Antibody (H00000631-M02).
 

Pathways for Filensin Antibody (H00000631-M02)

View related products by pathway.

Research Areas for Filensin Antibody (H00000631-M02)

Find related products by research area.

Blogs on Filensin

There are no specific blogs for Filensin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Filensin Antibody (6B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol BFSP1
Entrez
OMIM
Uniprot