FIGN Antibody (2F8) - Azide and BSA Free

Western Blot: FIGN Antibody (2F8) [H00055137-M02-100ug] - Detection against Immunogen (36.08 KDa)

Western Blot: FIGN Antibody (2F8) [H00055137-M02-100ug] - Analysis of FIGN expression in HeL

ELISA: FIGN Antibody (2F8) [H00055137-M02-100ug] - Detection limit for recombinant GST tagged FIGN is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FIGN Antibody (2F8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FIGN Antibody (2F8) - Azide and BSA Free (H00055137-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FIGN (NP_060556.2, 77 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GILEGPVDRPVLSNYSDTPSGLVNGRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FIGN
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FIGN Antibody (2F8) - Azide and BSA Free

• fidgetin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FIGN
• Entrez:
  • 55137(Human)
• OMIM:
  • 605295(Human)
• Uniprot:
  • NP_060556.2(Human)