Fibroblast Activation Protein alpha/FAP Antibody (1E5)

Images

 
Western Blot: Fibroblast Activation Protein alpha/FAP Antibody (1E5) [H00002191-M01] - Analysis of FAP expression in transfected 293T cell line by FAP monoclonal antibody (M01), clone 1E5.Lane 1: FAP transfected ...read more
Western Blot: Fibroblast Activation Protein alpha/FAP Antibody (1E5) [H00002191-M01] - FAP monoclonal antibody (M01), clone 1E5 Analysis of FAP expression in HepG2.
Immunoprecipitation: Fibroblast Activation Protein alpha/FAP Antibody (1E5) [H00002191-M01] - Analysis of FAP transfected lysate using anti-FAP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FAP ...read more
ELISA: Fibroblast Activation Protein alpha/FAP Antibody (1E5) [H00002191-M01] - Fibroblast Activation Protein alpha/FAP Antibody (1E5) [H00002191-M01] - Detection limit for recombinant GST tagged FAP is approximately ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibroblast Activation Protein alpha/FAP Antibody (1E5) Summary

Immunogen
FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS
Specificity
FAP - fibroblast activation protein, alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00002191-M01 in the following applications:

Publications
Read Publications using H00002191-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibroblast Activation Protein alpha/FAP Antibody (1E5)

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAP
  • FAPA
  • Fibroblast Activation Protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Seprase
  • vibronectin

Background

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-01830
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00004595-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)(5)

Review for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002191-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Fibroblast Activation Protein alpha/FAP H00002191-M01
Enlarge
5
reviewed by:
Christian Zuppinger
WB Human 07/14/2016
View

Summary

ApplicationWestern Blot
Sample Testedlysates of 2D standard cultures of primary cardiac fibroblasts, RIPA or Laemmli lysate buffer was used
SpeciesHuman
LotF4281-1E5

Blocking

Blocking Detailsmembranes were blocked with skim milk in PBS for 1 hour in the fridge

Primary Anitbody

Dilution Ratio1:500 in skim milk in PBS, incubation overnight in the fridge

Secondary Antibody

Secondary DescriptionGoat anti-Mouse IgG (H+L) Secondary Antibody, Alexa Fluor® 790
Secondary Manufacturer Cat#A11357
Secondary Concentration1:5000 in skim milk/PBS

Details

Detection NotesLicor Odyssey scanner

Comments

Commentsthe red bands on the image are GAPDH used as a loading control

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fibroblast Activation Protein alpha/FAP Products

Bioinformatics Tool for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)

Discover related pathways, diseases and genes to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)

Discover more about diseases related to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01).
 

Pathways for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)

View related products by pathway.

PTMs for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)

Learn more about PTMs related to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01).
 

Research Areas for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M01)

Find related products by research area.

Blogs on Fibroblast Activation Protein alpha/FAP

There are no specific blogs for Fibroblast Activation Protein alpha/FAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Christian Zuppinger
07/14/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol FAP
Entrez
OMIM
Uniprot