FGD3 Antibody (4E6) - Azide and BSA Free

Sandwich ELISA: FGD3 Antibody (4E6) [H00089846-M09] - Detection limit for recombinant GST tagged FGD3 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FGD3 Antibody (4E6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FGD3 Antibody (4E6) - Azide and BSA Free (H00089846-M09) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FGD3 (NP_149077, 83 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKVTPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYV
• Specificity: Reacts with FYVE, RhoGEF and PH domain containing 3.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FGD3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGD3 Antibody (4E6) - Azide and BSA Free

• FGD1 family, member 3
• FLJ00004
• FYVE, RhoGEF and PH domain containing 3
• FYVE, RhoGEF and PH domain-containing protein 3
• GCCD2
• GCCD3
• MGC117260
• ZFYVE5faciogenital dysplasia 3
• Zinc finger FYVE domain-containing protein 5

Background

Promotes the formation of filopodia. May activate CDC42, a member of the Ras-like family of Rho- and Racproteins, by exchanging bound GDP for free GTP. Plays a role in regulating the actin cytoskeleton and cell shape (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGD3
• Entrez:
  • 89846(Human)
• Uniprot:
  • NP_149077(Human)