FFAR4/GPR120 Antibody - BSA Free

Western Blot: FFAR4/GPR120 Antibody [NBP2-84932] - WB Suggested Anti-O3FAR1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Western Blot: FFAR4/GPR120 Antibody [NBP2-84932] - Host: Rabbit. Target: FFAR4. Positive control (+): Human lung (LU). Negative control (-): Human liver (LI). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FFAR4/GPR120 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of FFAR4/GPR120. Peptide sequence: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FFAR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FFAR4/GPR120 Antibody - BSA Free

• FFAR4
• G protein-coupled receptor 120
• G protein-coupled receptor 129
• G protein-coupled receptor PGR4
• GPR120
• GPR129
• G-protein coupled receptor 120
• G-protein coupled receptor 129
• G-protein coupled receptor GT01
• G-protein coupled receptor PGR4
• G-protein-coupled receptor GT01
• GT01
• MGC119984
• O3FAR1
• omega-3 fatty acid receptor 1
• PGR4
• PGR4DKFZp686F0824

Background

GPR120 is an Orphan-A GPCR with no known ligand. An EST has been isolated from a human colon cancer library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FFAR4