Ferroportin/SLC40A1 Recombinant Protein Antigen

Images

 
There are currently no images for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ferroportin/SLC40A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ferroportin/SLC40A1.

Source: E. coli

Amino Acid Sequence: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC40A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49454.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
62.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ferroportin/SLC40A1 Recombinant Protein Antigen

  • Ferroportin
  • Ferroportin-1
  • FPN1
  • FPN1IREG1ferroportin 1
  • HFE4
  • HFE4ferroportin-1
  • IREG1
  • iron regulated gene 1
  • Iron-regulated transporter 1
  • member 3
  • MST079
  • MSTP079
  • MTP1
  • putative ferroportin 1 variant IIIB
  • SLC11A3
  • SLC11A3iron regulated gene 1
  • SLC40A1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3
  • solute carrier family 40 (iron-regulated transporter), member 1
  • solute carrier family 40 member 1

Background

Ferroportin is a 12-transmembrane domain protein, belonging to the major facilitator superfamily of transporters of small molecules, that is localized to the plasma membrane. Human Ferroportin has a theoretical molecular weight of 62.5 kDa. Ferroportin (FPN1 or SLC40A1) functions as an iron-regulated transporter (highly expressed in placenta, intestine, muscle, spleen, macrophages etc.) and is the receptor for the iron-regulatory hormone, hepcidin. In iron metabolism, FPN1 plays a key role in intestinal iron absorption as well as cellular iron release and mediates iron absorption in the presence of ferroxidases, hephaestin (HP) and/or ceruloplasmin (CP). FPN1 is implicated in iron export from duodenal epithelial cells and in the transfer of iron between maternal and fetal circulation. FPN1 transports iron in the ferrous form whereas plasma transferrin only binds iron's ferric form. Ferroxidases are key players in oxidizing iron transported by FPN1 and without the activity of ferroxidases, FPN1 is internalized followed by degradation. While other cell types utilize the circulating or GPI-linked multicopper ferroxidase CP for FPN1, intestinal cells utilize a membrane-bound HP, a paralog of CP that also show interaction with FPN1 (1).

FPN1 regulation is dependent on the cell type and involves transcriptional, posttranscriptional, and posttranslational mechanisms including hepcidin-mediated endocytosis and proteolysis. Hepcidin controls the concentration of FPN1 in the membrane, with hepcidin deficiency resulting in iron overload (high iron) and hepcidin excess leading to iron restriction and anemia (2). Ferroportin disease or hemochromatosis type 4 (HFE4) is associated with distinct FPN1 variants with either reduced FPN1 cell surface expression/iron export capacity or hepcidin resistance and iron overload (3, 4).

References

1. De Domenico I, Ward DM, Kaplan J. (2011) Hepcidin and ferroportin: the new players in iron metabolism. Semin Liver Dis. 31(3):272-9. PMID: 21901657

2. Drakesmith H, Nemeth E, Ganz T. (2015) Ironing out Ferroportin. Cell Metab. 22(5):777-87. PMID: 26437604

3. Pietrangelo A. (2017) Ferroportin disease: pathogenesis, diagnosis and treatment. Haematologica. 102(12):1972-1984. PMID: 29101207

4. Vlasveld LT, Janssen R, Bardou-Jacquet E, Venselaar H, Hamdi-Roze H, Drakesmith H, Swinkels DW. (2019) Twenty Years of Ferroportin Disease: A Review or An Update of Published Clinical, Biochemical, Molecular, and Functional Features. Pharmaceuticals (Basel). 12(3). pii: E132. PMID: 31505869

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DHP250
Species: Hu
Applications: ELISA
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-84071
Species: Hu
Applications: IHC, IHC-P, WB
MAB7509
Species: Hu
Applications: IHC, KO, WB
AF3720
Species: Hu, Mu
Applications: ICC, WB
MAB3120
Species: Hu
Applications: Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP3-41278
Species: Hu, Mu
Applications: IHC, WB
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA

Publications for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP) (0)

There are no publications for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP) (0)

There are no reviews for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ferroportin/SLC40A1 Products

Research Areas for Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP)

Find related products by research area.

Blogs on Ferroportin/SLC40A1

There are no specific blogs for Ferroportin/SLC40A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ferroportin/SLC40A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC40A1