FBXW7/Cdc4 Antibody

Western Blot: FBXW7/Cdc4 Antibody [H00055294-B01P] - Analysis of FBXW7 expression in transfected 293T cell line by FBXW7 polyclonal antibody. Lane 1: FBXW7 transfected lysate(68.97 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: FBXW7/Cdc4 Antibody [H00055294-B01P] - Analysis of purified antibody to FBXW7 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

FBXW7/Cdc4 Antibody Summary

• Immunogen: FBXW7 (NP_060785.2, 1 a.a. - 627 a.a.) full-length human protein. MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
• Specificity: FBXW7 - F-box and WD repeat domain containing 7,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FBXW7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXW7/Cdc4 Antibody

• AGO
• AGOFBXO30
• Archipelago Homolog
• archipelago, Drosophila, homolog of
• Cdc4
• CDC4FLJ16457
• F-box and WD repeat domain containing 7
• F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)
• F-box and WD-40 domain-containing protein 7
• F-box protein FBW7
• F-box protein FBX30
• F-box protein SEL-10
• F-box/WD repeat-containing protein 7
• FBW6
• Fbw7
• FBW7hCdc4
• FBX30
• FBX30FLJ11071
• FBXO30
• FBXW6
• FBXW7
• hAgo
• homolog of C elegans sel-10
• SCF(Fbw7)
• SEL10
• SEL-10DKFZp686F23254
• SEL10FBW6

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXW7/Cdc4 Antibody (H00055294-B01P)(1)

Publication using H00055294-B01P

• Dipak Maskey, Matthew Caleb Marlin, Seokho Kim et al. Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length. EMBO J 2015 Jul 23. 2015-06-23 [PMID: 26206584]

Bioinformatics

• Gene Symbol: FBXW7
• Entrez:
  • 55294(Human)
• Uniprot:
  • NP_060785.2(Human)