FBXW12 Antibody

Images

 
Western Blot: FBXW12 Antibody [NBP2-30761] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: FBXW12 Antibody [NBP2-30761] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXW12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PQVFLTESLLRPSEGSVPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FBXW12 Protein (NBP2-30761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXW12 Antibody

  • F-box and WD repeat domain containing 12
  • F-box and WD-40 domain-containing protein 12
  • F-box- and WD40-repeat-containing protein
  • F-box only protein 35MGC120386
  • F-box/WD repeat-containing protein 12
  • Fbw12
  • FBW12MGC120387
  • FBXO12FBXO35F-box and WD-40 domain protein 12
  • MGC120385

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-84715
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1300
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30761
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FBXW12 Antibody (NBP2-30761) (0)

There are no publications for FBXW12 Antibody (NBP2-30761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW12 Antibody (NBP2-30761) (0)

There are no reviews for FBXW12 Antibody (NBP2-30761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW12 Antibody (NBP2-30761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXW12 Products

Bioinformatics Tool for FBXW12 Antibody (NBP2-30761)

Discover related pathways, diseases and genes to FBXW12 Antibody (NBP2-30761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FBXW12

There are no specific blogs for FBXW12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW12
Uniprot