Recombinant Human FBXO45 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXO45 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 39-148 of Human FBXO45

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO45
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00200933-Q01 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXO45 GST (N-Term) Protein

  • F-box only protein 45
  • F-box protein 45
  • F-box/SPRY domain-containing protein 1
  • Fbx45

Background

Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28489
Species: Rt
Applications: WB, PEP-ELISA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67386
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF6214
Species: Hu, Mu
Applications: WB
NB100-1289
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for FBXO45 Partial Recombinant Protein (H00200933-Q01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FBXO45 Partial Recombinant Protein (H00200933-Q01) (0)

There are no reviews for FBXO45 Partial Recombinant Protein (H00200933-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO45 Partial Recombinant Protein (H00200933-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FBXO45 Products

Array H00200933-Q01

Bioinformatics Tool for FBXO45 Partial Recombinant Protein (H00200933-Q01)

Discover related pathways, diseases and genes to FBXO45 Partial Recombinant Protein (H00200933-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO45 Partial Recombinant Protein (H00200933-Q01)

Discover more about diseases related to FBXO45 Partial Recombinant Protein (H00200933-Q01).
 

Pathways for FBXO45 Partial Recombinant Protein (H00200933-Q01)

View related products by pathway.

PTMs for FBXO45 Partial Recombinant Protein (H00200933-Q01)

Learn more about PTMs related to FBXO45 Partial Recombinant Protein (H00200933-Q01).

Blogs on FBXO45

There are no specific blogs for FBXO45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXO45 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO45