FBXO45 Antibody Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human FBXO45. Peptide sequence: IRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHA The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species |
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FBXO45 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for FBXO45 Antibody
Background
F-box/SPRY domain-containing protein 1, also known as F-box only protein 45 and FBXO45, is a component of the E3 ubiquitin ligase complex. FBXO45 is required for normal neuromuscular synaptogenesis, neuronal migration and axon pathfinding. FBXO45 also plays a role in regulating neurotransmission by mature neurons and controlling synaptic activity via UNC13A in the ubiquitin dependent pathway. FBXO45 protein recognizes TP73 and promotes it ubiquitination and degradation. FBXO45 expression is down regulated in response to DNA damage.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for FBXO45 Antibody (NBP2-82765) (0)
There are no publications for FBXO45 Antibody (NBP2-82765).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FBXO45 Antibody (NBP2-82765) (0)
There are no reviews for FBXO45 Antibody (NBP2-82765).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FBXO45 Antibody (NBP2-82765) (0)
Secondary Antibodies
| |
Isotype Controls
|
Blogs on FBXO45