FBXO45 Antibody

Western Blot: FBXO45 Antibody [NBP2-82765] - WB Suggested Anti-FBXO45 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell

Western Blot: FBXO45 Antibody [NBP2-82765] - Host: Rabbit. Target: FBXO45. Positive control (+): Human brain (BR). Negative control (-): 293T (2T). Antibody concentration: 0.25ug/ml

Product Discontinued

FBXO45 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FBXO45. Peptide sequence: IRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHA The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO45
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXO45 Antibody

• F-box only protein 45
• F-box protein 45
• F-box/SPRY domain-containing protein 1
• Fbx45

Background

F-box/SPRY domain-containing protein 1, also known as F-box only protein 45 and FBXO45, is a component of the E3 ubiquitin ligase complex. FBXO45 is required for normal neuromuscular synaptogenesis, neuronal migration and axon pathfinding. FBXO45 also plays a role in regulating neurotransmission by mature neurons and controlling synaptic activity via UNC13A in the ubiquitin dependent pathway. FBXO45 protein recognizes TP73 and promotes it ubiquitination and degradation. FBXO45 expression is down regulated in response to DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO45