FBXO2 Antibody

Immunocytochemistry/Immunofluorescence: FBXO2 Antibody [NBP2-55140] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Discontinued

FBXO2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FBXO2 Antibody

• FBG1
• F-box gene 1
• F-box only protein 2
• F-box protein 2
• Fbs1
• FBX2Fbg1
• NFB42
• OCP1
• organ of Corti protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXO2 Antibody (NBP2-55140)(1)

Publication using NBP2-55140

• Yamada A, Hikichi M, Nozawa T, Nakagawa I FBXO2/SCF ubiquitin ligase complex directs xenophagy through recognizing bacterial surface glycan EMBO reports 2021-09-13 [PMID: 34515398]

Bioinformatics

• Gene Symbol: FBXO2