FBXL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXL3 Antibody [NBP2-58640] - Staining of human cell line PC-3 shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS
Specificity
Specificity of human FBXL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXL3 Recombinant Protein Antigen (NBP2-58640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FBXL3 Antibody

  • FBL3AF-box and leucine-rich repeat protein 3AF-box protein Fbl3a
  • FBL3F-box/LRR-repeat protein 3
  • F-box and leucine-rich repeat protein 3
  • F-box/LRR-repeat protein 3A
  • FBXL3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP1-52158
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
6507-IL/CF
Species: Hu
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1300
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP2-58640
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for FBXL3 Antibody (NBP2-58640) (0)

There are no publications for FBXL3 Antibody (NBP2-58640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL3 Antibody (NBP2-58640) (0)

There are no reviews for FBXL3 Antibody (NBP2-58640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXL3 Antibody (NBP2-58640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FBXL3 Antibody (NBP2-58640)

Discover related pathways, diseases and genes to FBXL3 Antibody (NBP2-58640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL3 Antibody (NBP2-58640)

Discover more about diseases related to FBXL3 Antibody (NBP2-58640).
 

Pathways for FBXL3 Antibody (NBP2-58640)

View related products by pathway.

PTMs for FBXL3 Antibody (NBP2-58640)

Learn more about PTMs related to FBXL3 Antibody (NBP2-58640).

Blogs on FBXL3

There are no specific blogs for FBXL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL3