FBXL18 Antibody (3H5)

Images

 
Western Blot: FBXL18 Antibody (3H5) [H00080028-M01] - FBXL18 monoclonal antibody (M01), clone 3H5 Analysis of FBXL18 expression in A-431.
Immunohistochemistry-Paraffin: FBXL18 Antibody (3H5) [H00080028-M01] - Analysis of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: FBXL18 Antibody (3H5) [H00080028-M01] - Detection limit for recombinant GST tagged FBXL18 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FBXL18 Antibody (3H5) Summary

Immunogen
FBXL18 (NP_079239, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
Specificity
FBXL18 - F-box and leucine-rich repeat protein 18
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBXL18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXL18 Antibody (3H5)

  • Fbl18
  • F-box and leucine-rich repeat protein 18FLJ38075
  • F-box/LRR-repeat protein 18
  • FLJ10776
  • FLJ11467
  • FLJ26934
  • FLJ41541

Background

Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, KO, ELISA(Sta)
NBP2-43654
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00026260-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-91891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16542
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-27364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for FBXL18 Antibody (H00080028-M01) (0)

There are no publications for FBXL18 Antibody (H00080028-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL18 Antibody (H00080028-M01) (0)

There are no reviews for FBXL18 Antibody (H00080028-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL18 Antibody (H00080028-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBXL18 Products

Bioinformatics Tool for FBXL18 Antibody (H00080028-M01)

Discover related pathways, diseases and genes to FBXL18 Antibody (H00080028-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL18 Antibody (H00080028-M01)

Discover more about diseases related to FBXL18 Antibody (H00080028-M01).

Blogs on FBXL18

There are no specific blogs for FBXL18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXL18 Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL18
Entrez
OMIM
Uniprot