FAT3 Antibody

Images

 
Immunohistochemistry-Paraffin: FAT3 Antibody [NBP1-90642] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDACKRSPCQHGGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAT3 Protein (NBP1-90642PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAT3 Antibody

  • cadherin family member 15
  • cadherin-related family member 10
  • CDHF15
  • CDHR10
  • FAT tumor suppressor homolog 3 (Drosophila)
  • FLJ30341
  • hFat3
  • KIAA1989
  • protocadherin Fat 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
NBP2-53235
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-78381
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7979
Species: Hu, Mu, Rt
Applications: WB
AF7164
Species: Hu
Applications: WB
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NLS418
Species: Hu
Applications: IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for FAT3 Antibody (NBP1-90642) (0)

There are no publications for FAT3 Antibody (NBP1-90642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAT3 Antibody (NBP1-90642) (0)

There are no reviews for FAT3 Antibody (NBP1-90642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAT3 Antibody (NBP1-90642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAT3 Products

FAT3 NBP1-90642

Bioinformatics Tool for FAT3 Antibody (NBP1-90642)

Discover related pathways, diseases and genes to FAT3 Antibody (NBP1-90642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAT3 Antibody (NBP1-90642)

Discover more about diseases related to FAT3 Antibody (NBP1-90642).
 

Pathways for FAT3 Antibody (NBP1-90642)

View related products by pathway.

PTMs for FAT3 Antibody (NBP1-90642)

Learn more about PTMs related to FAT3 Antibody (NBP1-90642).

Blogs on FAT3

There are no specific blogs for FAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAT3