FARP1 Antibody (2D4) - Azide and BSA Free

Western Blot: FARP1 Antibody (2D4) [H00010160-M01] - WB validation of FARP1 monoclonal antibody (clone M01) against its immunogen (partial recombinant protein AA 471 - 549 with GST tag, 34.43 KDa; MW of the GST tag alone is 26 KDa).

Immunocytochemistry/Immunofluorescence: FARP1 Antibody (2D4) [H00010160-M01] - Analysis of monoclonal antibody to FARP1 on HeLa cell . Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: FARP1 Antibody (2D4) [H00010160-M01] - High expression of FARP1 is associated with poor prognosis in gastric cancer. Intensity of anti-FARP1 staining in the cytoplasm of gastric cancer cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41389-020-0190-7) licensed under a CC-BY license.

Immunohistochemistry: FARP1 Antibody (2D4) [H00010160-M01] - High expression of FARP1 is associated with poor prognosis in gastric cancer.a List of Rho GEF genes significantly correlated with poor prognosis of patients with gastric cancer. b Relationship between FARP1 expression & overall survival of patients with gastric cancer as assessed using the Kaplan–Meier plotter. c Gene expression of FARP1 in solid normal tissue & primary gastric cancer. Magnification, ×200; scale bar, 200 μm. d Intensity of anti-FARP1 staining in the cytoplasm of gastric cancer cells. e Overall survival of patients with gastric cancer within high & low FARP1 expression grouped according to immunohistochemistry assessment. Survival rates were calculated by the Kaplan–Meier method, & differences in survival were estimated by the log-rank test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32029704), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FARP1 Antibody (2D4) - Azide and BSA Free Summary

• Immunogen: FARP1 (NP_005757.1, 471 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS
• Specificity: FARP1 - FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) (2D4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FARP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35262173).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FARP1 Antibody (2D4) - Azide and BSA Free

• CDEPPleckstrin homology domain-containing family C member 2
• Chondrocyte-derived ezrin-like protein
• FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
• FERM, RhoGEF and pleckstrin domain-containing protein 1
• MGC87400
• PLEKHC2PH domain-containing family C member 2

Background

This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FARP1 Antibody (H00010160-M01)(2)

Publications using H00010160-M01

• Kleffman K, Levinson G, Rose IVL et al. Melanoma-secreted Amyloid Beta Suppresses Neuroinflammation and Promotes Brain Metastasis Cancer discovery 2022-02-24 [PMID: 35262173] (WB, Mouse)
• Hirano T, Shinsato Y, Tanabe K et al. FARP1 boosts CDC42 activity from integrin alpha v beta 5 signaling and correlates with poor prognosis of advanced gastric cancer Oncogenesis 2020-02-06 [PMID: 32029704] (WB, Human)

Bioinformatics

• Gene Symbol: FARP1
• Entrez:
  • 10160(Human)
• Uniprot:
  • NP_005757(Human)