FAM59A Antibody

Images

 
Immunohistochemistry-Paraffin: FAM59A Antibody [NBP2-48757] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM59A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GNSEVNLHGCRDLGGDWAPFPHDILPYQDSGDSGSDYLFPEASEESAGIPGKSELPYEELWLEEGKPSHQPLTRSLSEKNRCDQFRGSVRSKCATSPLPIP
Specificity
Specificity of human FAM59A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAREM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM59A Recombinant Protein Antigen (NBP2-48757PEP)

Reactivity Notes

Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM59A Antibody

  • Chromosome 18 Open Reading Frame 11
  • chromosome 18 open reading frame 11, family with sequence
  • FAM59A
  • Family With Sequence Similarity 59, Member A
  • FLJ21610
  • GAREM
  • Gm944
  • GRB2 associated, regulator of MAPK1
  • Grb2-Associated And Regulator Of Erk/MAPK
  • GRB2-Associated And Regulator Of MAPK Protein
  • GRB2-Associated And Regulator Of MAPK1
  • Protein FAM59A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
PP-H7833-00
Species: Hu
Applications: WB, IP
NBP1-82904
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30691
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90744
Species: Hu
Applications: IHC, IHC-P
NBP2-37742
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-34005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86710
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37316
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FAM59A Antibody (NBP2-48757) (0)

There are no publications for FAM59A Antibody (NBP2-48757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM59A Antibody (NBP2-48757) (0)

There are no reviews for FAM59A Antibody (NBP2-48757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM59A Antibody (NBP2-48757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM59A Products

Bioinformatics Tool for FAM59A Antibody (NBP2-48757)

Discover related pathways, diseases and genes to FAM59A Antibody (NBP2-48757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM59A Antibody (NBP2-48757)

Discover more about diseases related to FAM59A Antibody (NBP2-48757).
 

Pathways for FAM59A Antibody (NBP2-48757)

View related products by pathway.

PTMs for FAM59A Antibody (NBP2-48757)

Learn more about PTMs related to FAM59A Antibody (NBP2-48757).

Blogs on FAM59A

There are no specific blogs for FAM59A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM59A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAREM1