FAM59A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FAM59A Antibody [NBP2-47460] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry: FAM59A Antibody [NBP2-47460] - Staining of human cerebral cortex shows moderate nuclear staining in neuronal cells

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM59A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM59A Antibody - BSA Free (NBP2-47460) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILPMHFPLHLTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYARDELTQS
• Predicted Species: Mouse (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAREM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM59A Protein (NBP2-47460PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM59A Antibody - BSA Free

• Chromosome 18 Open Reading Frame 11
• chromosome 18 open reading frame 11, family with sequence
• FAM59A
• Family With Sequence Similarity 59, Member A
• FLJ21610
• GAREM
• Gm944
• GRB2 associated, regulator of MAPK1
• Grb2-Associated And Regulator Of Erk/MAPK
• GRB2-Associated And Regulator Of MAPK Protein
• GRB2-Associated And Regulator Of MAPK1
• Protein FAM59A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAREM1