FAM124B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM124B Antibody [NBP2-49625] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM124B Antibody [NBP2-49625] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: FAM124B Antibody [NBP2-49625] - Staining of human cerebral cortex shows weak nuclear positivity in neurons.
Immunohistochemistry-Paraffin: FAM124B Antibody [NBP2-49625] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: FAM124B Antibody [NBP2-49625] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM124B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM124B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM124B Recombinant Protein Antigen (NBP2-49625PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM124B Antibody

  • family with sequence similarity 124B
  • FLJ22746
  • hypothetical protein LOC79843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77393
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87486
Species: Hu
Applications: IHC, IHC-P, WB
NB100-60417
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-13957
Species: Hu
Applications: IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84083
Species: Hu
Applications: IHC, IHC-P
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00149175-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49625
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FAM124B Antibody (NBP2-49625) (0)

There are no publications for FAM124B Antibody (NBP2-49625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM124B Antibody (NBP2-49625) (0)

There are no reviews for FAM124B Antibody (NBP2-49625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM124B Antibody (NBP2-49625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM124B Products

Bioinformatics Tool for FAM124B Antibody (NBP2-49625)

Discover related pathways, diseases and genes to FAM124B Antibody (NBP2-49625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM124B Antibody (NBP2-49625)

Discover more about diseases related to FAM124B Antibody (NBP2-49625).
 

Pathways for FAM124B Antibody (NBP2-49625)

View related products by pathway.

PTMs for FAM124B Antibody (NBP2-49625)

Learn more about PTMs related to FAM124B Antibody (NBP2-49625).

Blogs on FAM124B

There are no specific blogs for FAM124B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM124B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM124B