FAM123A Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM123A Antibody [NBP1-93907] - Staining in human cerebral cortex and pancreas tissues using anti-AMER2 antibody. Corresponding AMER2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: FAM123A Antibody [NBP1-93907] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: FAM123A Antibody [NBP1-93907] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FAM123A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM123A Protein (NBP1-93907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM123A Antibody

  • family with sequence similarity 123A
  • FLJ25477

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM123A Antibody (NBP1-93907) (0)

There are no publications for FAM123A Antibody (NBP1-93907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM123A Antibody (NBP1-93907) (0)

There are no reviews for FAM123A Antibody (NBP1-93907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM123A Antibody (NBP1-93907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM123A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMER2