FAM119B Antibody

Images

 
Immunohistochemistry-Paraffin: FAM119B Antibody [NBP2-14233] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM119B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQR DEDENVNIYRARHREPRPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL21B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM119B Protein (NBP2-14233PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%) Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM119B Antibody

  • DKFZP586D0919
  • EC 2.1.1.-
  • FAM119B
  • family with sequence similarity 119, member B
  • HCA557A
  • Hepatocellular carcinoma-associated antigen 557a
  • hepatocellularcarcinoma-associated antigen HCA557a
  • hypothetical protein LOC25895
  • methyltransferase like 21B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-20746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-88246
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP1-91550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56992
Species: Hu
Applications: WB
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-84549
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46374
Species: Hu
Applications: WB, IHC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-34118
Species: Hu
Applications: IHC, IHC-P

Publications for FAM119B Antibody (NBP2-14233) (0)

There are no publications for FAM119B Antibody (NBP2-14233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM119B Antibody (NBP2-14233) (0)

There are no reviews for FAM119B Antibody (NBP2-14233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM119B Antibody (NBP2-14233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM119B Products

Bioinformatics Tool for FAM119B Antibody (NBP2-14233)

Discover related pathways, diseases and genes to FAM119B Antibody (NBP2-14233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM119B

There are no specific blogs for FAM119B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM119B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL21B