EZH1 Antibody

Western Blot: EZH1 Antibody [NBP2-87384] - WB Suggested Anti-EZH1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain

Chromatin Immunoprecipitation: EZH1 Antibody [NBP2-87384] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Product Discontinued

EZH1 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human EZH1. Peptide sequence: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EZH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EZH1 Antibody

• EC 2.1.1.356
• EC 2.1.1.43
• enhancer of zeste homolog 1 (Drosophila)
• Enhancer of zeste homolog 1
• ENX-2
• EZH1
• histone-lysine N-methyltransferase EZH1
• KIAA0388
• KIAA0388enhancer of zeste (Drosophila) homolog 1
• KMT6B

Background

EZH1 is a human homolog of the Drosophila gene Enhancer of zeste E(z), a member of the polycomb group of transcriptional repressors. In mice, EZH1 is a regulator of homeotic gene expression implicated in the assembly of repressive protein complexes in chromatin. The strong sequence conservation between species suggests potential role for EZH1 in human development as a transcriptional regulator and as a component of protein complexes that stably maintain heterochromatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EZH1