EXPH5 Antibody

Images

 
Western Blot: EXPH5 Antibody [NBP1-80506] - ACHN cell lysate, concentration 0.2-1 ug/ml.
Western Blot: EXPH5 Antibody [NBP1-80506] - Human sperm extract.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EXPH5 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human EXPH5. Peptide sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXPH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EXPH5 and was validated on Western blot.
Theoretical MW
222 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EXPH5 Antibody

  • DKFZp781H0795
  • exophilin 5
  • SLAC2B
  • synaptotagmin-like homologue lacking C2 domains b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005874-B01P
Species: Hu, Rb
Applications: WB, ICC/IF
NBP2-24500
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90781
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80506
Species: Hu
Applications: WB

Publications for EXPH5 Antibody (NBP1-80506) (0)

There are no publications for EXPH5 Antibody (NBP1-80506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXPH5 Antibody (NBP1-80506) (0)

There are no reviews for EXPH5 Antibody (NBP1-80506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EXPH5 Antibody (NBP1-80506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EXPH5 Products

EXPH5 NBP1-80506

Bioinformatics Tool for EXPH5 Antibody (NBP1-80506)

Discover related pathways, diseases and genes to EXPH5 Antibody (NBP1-80506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXPH5 Antibody (NBP1-80506)

Discover more about diseases related to EXPH5 Antibody (NBP1-80506).
 

Pathways for EXPH5 Antibody (NBP1-80506)

View related products by pathway.

Blogs on EXPH5

There are no specific blogs for EXPH5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXPH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXPH5
Uniprot