Exostosin 1 Antibody (5A5)

Images

 
Sandwich ELISA: Exostosin 1 Antibody (5A5) [H00002131-M01] - Detection limit for recombinant GST tagged EXT1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Exostosin 1 Antibody (5A5) Summary

Immunogen
EXT1 (AAH01174 246 a.a. - 345 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSF
Specificity
EXT1 - exostoses (multiple) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EXT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Exostosin 1 Antibody (5A5)

  • EC 2.4.1.224
  • EC 2.4.1.225
  • exostoses (multiple) 1
  • Exostosin 1
  • exostosin-1
  • EXT
  • EXT1
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase
  • Langer-Giedion syndrome chromosome region
  • LGCR
  • LGS
  • Multiple exostoses protein 1
  • N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
  • Putative tumor suppressor protein EXT1
  • TRPS2
  • TTV

Background

This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
1705-HH/CF
Species: Hu, Mu
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF2536
Species: Mu
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
AF4838
Species: Hu
Applications: WB, Simple Western
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-57016
Species: Hu
Applications: WB
MAB4214
Species: Mu
Applications: WB, IP
H00002131-M01
Species: Hu
Applications: WB, ELISA

Publications for Exostosin 1 Antibody (H00002131-M01) (0)

There are no publications for Exostosin 1 Antibody (H00002131-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exostosin 1 Antibody (H00002131-M01) (0)

There are no reviews for Exostosin 1 Antibody (H00002131-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exostosin 1 Antibody (H00002131-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exostosin 1 Products

Bioinformatics Tool for Exostosin 1 Antibody (H00002131-M01)

Discover related pathways, diseases and genes to Exostosin 1 Antibody (H00002131-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin 1 Antibody (H00002131-M01)

Discover more about diseases related to Exostosin 1 Antibody (H00002131-M01).
 

Pathways for Exostosin 1 Antibody (H00002131-M01)

View related products by pathway.

PTMs for Exostosin 1 Antibody (H00002131-M01)

Learn more about PTMs related to Exostosin 1 Antibody (H00002131-M01).
 

Research Areas for Exostosin 1 Antibody (H00002131-M01)

Find related products by research area.

Blogs on Exostosin 1

There are no specific blogs for Exostosin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exostosin 1 Antibody (5A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol EXT1
Entrez
Uniprot