Recombinant Human Exosome Component 9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Exosome Component 9 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 124 - 220 of Human EXOSC9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPID

Protein/Peptide Type
Partial Recombinant Protein
Gene
EXOSC9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Exosome Component 9 Protein

  • Autoantigen PM/Scl 1
  • EC 3.1.13
  • exosome component 9Polymyositis/scleroderma autoantigen 75 kDa
  • p6
  • PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen
  • PMSCL175kD
  • polymyositis/scleroderma autoantigen 1 (75kD)
  • Polymyositis/scleroderma autoantigen 1
  • polymyositis/scleroderma autoantigen 1, 75kDa

Background

EXOSC9 - exosome component 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC

Publications for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01) (0)

There are no publications for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01) (0)

There are no reviews for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Exosome Component 9 Products

Bioinformatics Tool for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01)

Discover related pathways, diseases and genes to Exosome Component 9 Partial Recombinant Protein (H00005393-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Exosome Component 9 Partial Recombinant Protein (H00005393-Q01)

View related products by pathway.

Blogs on Exosome Component 9

There are no specific blogs for Exosome Component 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Exosome Component 9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC9