Recombinant Human Exosome component 10 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human Exosome component 10 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human Exosome component 10
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: EXOSC10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Exosome component 10 GST (N-Term) Protein

• autoantigen PM-SCL
• EC 3.1.13.-
• exosome component 10
• P100 polymyositis-scleroderma overlap syndrome-associated autoantigen
• p2
• p3
• p4
• PM/Scl-100Autoantigen PM/Scl 2
• PM-Scl
• PMSCL2PMSCL
• polymyositis/scleroderma autoantigen 2 (100kD)
• Polymyositis/scleroderma autoantigen 2
• polymyositis/scleroderma autoantigen 2, 100kDa
• RRP6
• Rrp6p
• RRP6Polymyositis/scleroderma autoantigen 100 kDa

Background

Part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions. Required for the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. Could be an exonuclease . Plays a role in replication-dependent histone mRNA degradation. Mediates the association of MTR4, C1D and MPP6 wth the exosome and this complex is required for the maturation of 5.8S rRNA. Required for nucleolar localization of C1D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EXOSC10