Recombinant Human Exosome component 10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Exosome component 10 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 99 of Human EXOSC10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD

Protein/Peptide Type
Partial Recombinant Protein
Gene
EXOSC10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl buffer, pH 8.0, 1 mM dithiothreitol, 10% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Exosome component 10 Protein

  • autoantigen PM-SCL
  • EC 3.1.13.-
  • exosome component 10
  • P100 polymyositis-scleroderma overlap syndrome-associated autoantigen
  • p2
  • p3
  • p4
  • PM/Scl-100Autoantigen PM/Scl 2
  • PM-Scl
  • PMSCL2PMSCL
  • polymyositis/scleroderma autoantigen 2 (100kD)
  • Polymyositis/scleroderma autoantigen 2
  • polymyositis/scleroderma autoantigen 2, 100kDa
  • RRP6
  • Rrp6p
  • RRP6Polymyositis/scleroderma autoantigen 100 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Exosome component 10 Partial Recombinant Protein (H00005394-Q01) (0)

There are no publications for Exosome component 10 Partial Recombinant Protein (H00005394-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 10 Partial Recombinant Protein (H00005394-Q01) (0)

There are no reviews for Exosome component 10 Partial Recombinant Protein (H00005394-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 10 Partial Recombinant Protein (H00005394-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Exosome component 10 Products

Bioinformatics Tool for Exosome component 10 Partial Recombinant Protein (H00005394-Q01)

Discover related pathways, diseases and genes to Exosome component 10 Partial Recombinant Protein (H00005394-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 10 Partial Recombinant Protein (H00005394-Q01)

Discover more about diseases related to Exosome component 10 Partial Recombinant Protein (H00005394-Q01).
 

Pathways for Exosome component 10 Partial Recombinant Protein (H00005394-Q01)

View related products by pathway.

PTMs for Exosome component 10 Partial Recombinant Protein (H00005394-Q01)

Learn more about PTMs related to Exosome component 10 Partial Recombinant Protein (H00005394-Q01).

Blogs on Exosome component 10

There are no specific blogs for Exosome component 10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Exosome component 10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC10