Evx1 Antibody (1B7)

Images

 
Western Blot: Evx1 Antibody (1B7) [H00002128-M07] - Analysis of EVX1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Evx1 Antibody (1B7) [H00002128-M07] - Analysis of EVX1 expression in HeLa (Cat # L013V1).
Western Blot: Evx1 Antibody (1B7) [H00002128-M07] - Analysis of EVX1 expression in PC-12 (Cat # L012V1).
Western Blot: Evx1 Antibody (1B7) [H00002128-M07] - Analysis of EVX1 expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Evx1 Antibody (1B7) Summary

Immunogen
EVX1 (NP_001980, 2 a.a. - 110 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP*
Specificity
EVX1 (1B7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EVX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Evx1 Antibody (1B7)

  • eve, even-skipped homeo box homolog 1
  • eve, even-skipped homeobox homolog 1 (Drosophila)
  • eve, even-skipped homeobox homolog 1
  • even-skipped homeo box 1 (homolog of Drosophila)
  • even-skipped homeobox 1
  • EVX-1
  • homeobox even-skipped homolog protein 1

Background

This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90973
Species: Hu
Applications: ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-46076
Species: Hu
Applications: WB, IHC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
H00028299-P01
Species: Hu
AF2400
Species: Hu
Applications: WB, ChIP, ICC
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5014
Species: Hu
Applications: WB, ICC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
645-WN/CF
Species: Hu, Mu
NBP1-90978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002128-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Evx1 Antibody (H00002128-M07) (0)

There are no publications for Evx1 Antibody (H00002128-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Evx1 Antibody (H00002128-M07) (0)

There are no reviews for Evx1 Antibody (H00002128-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Evx1 Antibody (H00002128-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Evx1 Products

Bioinformatics Tool for Evx1 Antibody (H00002128-M07)

Discover related pathways, diseases and genes to Evx1 Antibody (H00002128-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Evx1 Antibody (H00002128-M07)

Discover more about diseases related to Evx1 Antibody (H00002128-M07).
 

Pathways for Evx1 Antibody (H00002128-M07)

View related products by pathway.

PTMs for Evx1 Antibody (H00002128-M07)

Learn more about PTMs related to Evx1 Antibody (H00002128-M07).

Blogs on Evx1

There are no specific blogs for Evx1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Evx1 Antibody (1B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol EVX1
Entrez
OMIM
Uniprot