Recombinant Human EVER2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EVER2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 616 - 674 of Human TMC8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SQTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TMC8
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EVER2 Protein

  • epidermodysplasia verruciformis 2
  • Epidermodysplasia verruciformis protein 2
  • EV2
  • EVER2MGC102701
  • EVIN2FLJ43684
  • FLJ40668
  • MGC40121
  • transmembrane channel-like 8
  • transmembrane channel-like protein 8

Background

Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 8 predicted transmembrane domains and 3 leucine zipper motifs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76892
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92514
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33277
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88816
Species: Hu
Applications: WB, IHC, IHC-P
H00023213-D01P
Species: Hu
Applications: WB, ELISA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-86240
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00147138-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EVER2 Partial Recombinant Protein (H00147138-Q01) (0)

There are no publications for EVER2 Partial Recombinant Protein (H00147138-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVER2 Partial Recombinant Protein (H00147138-Q01) (0)

There are no reviews for EVER2 Partial Recombinant Protein (H00147138-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EVER2 Partial Recombinant Protein (H00147138-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EVER2 Products

EVER2 H00147138-Q01

Bioinformatics Tool for EVER2 Partial Recombinant Protein (H00147138-Q01)

Discover related pathways, diseases and genes to EVER2 Partial Recombinant Protein (H00147138-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVER2 Partial Recombinant Protein (H00147138-Q01)

Discover more about diseases related to EVER2 Partial Recombinant Protein (H00147138-Q01).
 

Pathways for EVER2 Partial Recombinant Protein (H00147138-Q01)

View related products by pathway.

Blogs on EVER2

There are no specific blogs for EVER2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EVER2 Antibody
NBP1-76903

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EVER2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMC8