ESX1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ESX1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ESX1
  
  

  Source: E.coli

  Amino Acid Sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ESX1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24824It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ESX1 Recombinant Protein Antigen

• ESX homeobox 1
• ESX1LESX1R
• ESX1-related protein
• ESXR1homeobox protein ESX1
• extraembryonic, spermatogenesis, homeobox 1 homolog (mouse)
• extraembryonic, spermatogenesis, homeobox 1 homolog
• Extraembryonic, spermatogenesis, homeobox 1

Background

The ESX1 gene encodes a 406 amino acid long, 44kDA homeobox protein ESX1 that functions in cell cycle progression and transcription during spermatogenesis and plays a critical role in placental development. ESX1 interacts with genes EXOC2 and TRAP1 and is linked to diseases such as testicular germ cell tumors, delayed puberty, hypopituitarism, tuberculosis, and holoprosencephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ESX1