ESX1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ESX1 Source: E.coli
Amino Acid Sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ESX1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24824It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ESX1 Recombinant Protein Antigen
Background
The ESX1 gene encodes a 406 amino acid long, 44kDA homeobox protein ESX1 that functions in cell cycle progression and transcription during spermatogenesis and plays a critical role in placental development. ESX1 interacts with genes EXOC2 and TRAP1 and is linked to diseases such as testicular germ cell tumors, delayed puberty, hypopituitarism, tuberculosis, and holoprosencephaly.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Applications: IHC, Simple Western, WB
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
Applications: ChIP, ICC, IHC, Simple Western, WB
Publications for ESX1 Recombinant Protein Antigen (NBP3-24824PEP) (0)
There are no publications for ESX1 Recombinant Protein Antigen (NBP3-24824PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ESX1 Recombinant Protein Antigen (NBP3-24824PEP) (0)
There are no reviews for ESX1 Recombinant Protein Antigen (NBP3-24824PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ESX1 Recombinant Protein Antigen (NBP3-24824PEP) (0)
Additional ESX1 Products
Blogs on ESX1