ERRF Antibody

Images

 
Western Blot: C1orf64 Antibody [NBP1-81157] - Analysis in control (vector only transfected HEK293T lysate) and C1orf64 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: C1orf64 Antibody [NBP1-81157] - Staining of human breast shows weak nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERRF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1ORF64
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 29577611). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERRF Recombinant Protein Antigen (NBP1-81157PEP)
Publications
Read Publications using
NBP1-81157 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22341523)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERRF Antibody

  • chromosome 1 open reading frame 64
  • ERRF
  • MGC24047
  • putative uncharacterized protein C1orf64
  • RP11-5P18.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6487
Species: Hu
Applications: WB, ICC
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81157
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ERRF Antibody (NBP1-81157)(3)

Reviews for ERRF Antibody (NBP1-81157) (0)

There are no reviews for ERRF Antibody (NBP1-81157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERRF Antibody (NBP1-81157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ERRF Products

Bioinformatics Tool for ERRF Antibody (NBP1-81157)

Discover related pathways, diseases and genes to ERRF Antibody (NBP1-81157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERRF Antibody (NBP1-81157)

Discover more about diseases related to ERRF Antibody (NBP1-81157).
 

Pathways for ERRF Antibody (NBP1-81157)

View related products by pathway.

Blogs on ERRF

There are no specific blogs for ERRF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERRF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF64
Entrez