Epsin 3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Epsin 3 Antibody [NBP2-56896] - Staining of human cell line MCF7 shows localization to vesicles.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Epsin 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRT
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Epsin 3 Recombinant Protein Antigen (NBP2-56896PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Epsin 3 Antibody - BSA Free

• EPS-15-interacting protein 3
• epsin 3
• epsin-3
• FLJ20778
• MGC129899

Background

The EPSN3 gene encodes an epsin-3 protein that in isoform 1 is 632 amino acids long at 68 kDA and in isoform 2 is 208 amino acids long at 23 kDA. EPSN3 participates in endocytosis, germ cell-sertoli cell junction dynamics, and endocytic trafficking of EGFR through interactions with genes EGFR, ERBB4, CSF1R, and LAPTM5. EPSN3 has been linked to basal cell carcinoma and ulcerative colitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPN3