Epsin-2 Recombinant Protein Antigen

Images

 
There are currently no images for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Epsin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epsin-2.

Source: E. coli

Amino Acid Sequence: PLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EPN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58740.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Epsin-2 Recombinant Protein Antigen

  • Eps15 binding protein
  • EPS-15-interacting protein 2
  • epsin 2
  • epsin-2
  • KIAA1065EHB21

Background

Elucidation of the mechanism by which receptor tyrosine kinases (RTKs) modulate cellular physiology in response to stimuli is critical to the understanding of growth regulation. Miscues in RTK signaling pathways can result in cellular transformation and ultimately in cancer. Two novel EGF receptor substrates designated EGF-receptor pathway substrates 8 and 15, or Eps8 and Eps15, have been described. Epsin is a 90 kDa binding partner to Eps15. Both epsin and Eps15 have an ubiquitous tissue distribution but are concentrated in presynaptic nerve terminals specialized for the Clathrin-mediated endocytosis of synaptic vesicles. Disruption of epsin function blocks Clathrinmediated endocytosis. Epsin along with its binding partner Eps15 is proposed to be involved in the assistance of Clathrin coat rearrangement during Clathrin coated pit invagination. Epsin 2 and epsin 2a are also associated with Clathrin-mediated endocytosis and are enriched in the brain in the peri-Golgi region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8480
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-03439
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-56536
Species: Hu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-69313
Species: Hu
Applications: WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-20792
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86033
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-58740PEP
Species: Hu
Applications: AC

Publications for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP) (0)

There are no publications for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP) (0)

There are no reviews for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Epsin-2 Products

Research Areas for Epsin-2 Recombinant Protein Antigen (NBP2-58740PEP)

Find related products by research area.

Blogs on Epsin-2

There are no specific blogs for Epsin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Epsin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EPN2